// Set start to true only if the first key in the sequence is pressed "context" : "", }, "disableKudosForAnonUser" : "false", } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "initiatorBinding" : true, } { "event" : "unapproveMessage", { }, } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_54","feedbackSelector":".InfoMessage"}); "context" : "", { "entity" : "2462119", // console.log(key); "action" : "rerender" { }, "selector" : "#messageview_2", "context" : "envParam:feedbackData", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2462019}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2462114}},{"elementId":"link_19","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2462025}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2462046}},{"elementId":"link_27","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2462098}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2462114}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2462119}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2462127}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2462186}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2462561}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2462567}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2459463}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2496296}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2469222}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2460188}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2497294}},{"elementId":"link_62","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2503384}},{"elementId":"link_64","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2503349}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2503306}},{"elementId":"link_69","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2503208}},{"elementId":"link_71","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2503189}},{"elementId":"link_73","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2503095}},{"elementId":"link_75","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2503016}},{"elementId":"link_78","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2503013}},{"elementId":"link_80","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2502855}},{"elementId":"link_82","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2502792}}]); Fehlermeldung "Invalid input parameter(s): index" ... MAC-Filter in Vodafone Station funktioniert nicht ... Wechsel von 6590 auf 6591. "actions" : [ } ] "truncateBodyRetainsHtml" : "false", { logmein: [76, 79, 71, 77, 69, 73, 78], "action" : "rerender" ], LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "actions" : [ LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", } } "action" : "rerender" { } } { ', 'ajax'); "initiatorDataMatcher" : "data-lia-message-uid" "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); "action" : "rerender" "linkDisabled" : "false" ] "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, '72qZToAtDROlWhihpnVjlUtm8AkyjsrDm4ddEGg6Y8E. ', 'ajax'); }, { LITHIUM.AjaxSupport.ComponentEvents.set({ }); "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", "quiltName" : "ForumMessage", "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ { "context" : "envParam:entity", LITHIUM.Dialog.options['918828667'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" ] "actions" : [ "context" : "", "actions" : [ "actions" : [ } } LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'TUwFObWiYpOR_99iZKM9HEKBbWk2SF7J-a8uUhjmMIw. "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); { LITHIUM.Dialog.options['-1801815361'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "pulsate" "context" : "", "context" : "envParam:quiltName", "event" : "QuickReply", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'dc9Htal6LgSQZ-eWAm-0FsJH6GqGMrxnj-r3ARWm3Cg. }, LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } } }, ] "selector" : "#messageview_5", }, "entity" : "2462567", }, "context" : "", LITHIUM.Loader.runJsAttached(); "useSimpleView" : "false", "useSimpleView" : "false", "event" : "ProductAnswerComment", { }, "action" : "rerender" } } { "initiatorDataMatcher" : "data-lia-message-uid" { LITHIUM.Loader.runJsAttached(); { LITHIUM.Dialog.options['-792223173'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } { { } } }, }, if ( neededkeys[count] == key ) { "actions" : [ ] }, } LITHIUM.AjaxSupport.ComponentEvents.set({ if ( !watching ) { { "context" : "", LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "event" : "kudoEntity", { "action" : "rerender" { } // console.log('watching: ' + key); "action" : "rerender" "actions" : [ ], "action" : "rerender" { "context" : "envParam:quiltName,message", "showCountOnly" : "false", "action" : "rerender" { "revokeMode" : "true", ] "ajaxEvent" : "LITHIUM:lightboxRenderComponent", }, "action" : "rerender" "actions" : [ "event" : "MessagesWidgetEditAction", "context" : "envParam:quiltName,product,contextId,contextUrl", ;(function($) { "disableLinks" : "false", "event" : "QuickReply", { "action" : "rerender" ] "truncateBody" : "true", }, ] ', 'ajax'); ] "context" : "", { "actions" : [ Bist du sicher, dass du fortfahren möchtest? "actions" : [ ] Es ist jeder Netzwerkkarte nur 100mbit direkt auf Amazon.de erhältlich und somit sofort lieferbar. }); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2462127 .lia-rating-control-passive', '#form_6'); { }, "truncateBody" : "true", "context" : "", "event" : "MessagesWidgetMessageEdit", "action" : "rerender" "useSubjectIcons" : "true", "actions" : [ "actions" : [ "event" : "unapproveMessage", { ] "event" : "MessagesWidgetMessageEdit", }, "action" : "pulsate" "event" : "MessagesWidgetAnswerForm", "truncateBodyRetainsHtml" : "false", "event" : "RevokeSolutionAction", LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "context" : "envParam:feedbackData", ] }, "event" : "MessagesWidgetMessageEdit", { "context" : "", "event" : "addThreadUserEmailSubscription", ] { { "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "removeThreadUserEmailSubscription", { "action" : "rerender" }, "action" : "addClassName" } "disallowZeroCount" : "false", ;(function($) { ] "actions" : [ }, "actions" : [ { ] "actions" : [ { { "action" : "rerender" { "action" : "addClassName" ] } "action" : "pulsate" } "event" : "approveMessage", "}); ] } "context" : "", "parameters" : { "kudosable" : "true", { }, "selector" : "#messageview_4", "action" : "addClassName" { "action" : "rerender" } "actions" : [ { "initiatorBinding" : true, { { ] "useCountToKudo" : "false", "event" : "markAsSpamWithoutRedirect", { "event" : "ProductMessageEdit", "activecastFullscreen" : false, }, ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/162089","ajaxErrorEventName":"LITHIUM:ajaxError","token":"lk5q_7Ao8NBwjgbHI7vqbr027gq4GKBYj7qbbyUBFWk. "context" : "", "actions" : [ ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "truncateBodyRetainsHtml" : "false", ', 'ajax'); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "context" : "", } LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { $(document).ready(function(){ "event" : "MessagesWidgetEditAction", { "actions" : [ } "event" : "removeMessageUserEmailSubscription", "action" : "rerender" "context" : "", { "context" : "", "action" : "rerender" } } "includeRepliesModerationState" : "false", ] "actions" : [ "context" : "envParam:quiltName,message", "context" : "", } "actions" : [ "actions" : [ Execute whatever should happen when entering the right sequence "actions" : [ } "actions" : [ "context" : "envParam:quiltName", }); "action" : "rerender" }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2462127 .lia-rating-control-passive', '#form_6'); var keycodes = { } { ] Bist du sicher, dass du fortfahren möchtest? "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_50","feedbackSelector":".InfoMessage"}); ] "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "disallowZeroCount" : "false", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "actions" : [ "event" : "kudoEntity", "selector" : "#messageview_1", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2462119,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { })(LITHIUM.jQuery); // Pull in global jQuery reference ] ] count = 0; // We're good so far. }); }, }, }); "disableLinks" : "false", "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "event" : "removeMessageUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "addMessageUserEmailSubscription", ] } "kudosLinksDisabled" : "false", LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); "actions" : [ }, { "action" : "rerender" } { { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); "displayStyle" : "horizontal", "useCountToKudo" : "false", } ] }, }, ], "event" : "MessagesWidgetEditAnswerForm", "displaySubject" : "true", "action" : "rerender" "componentId" : "forums.widget.message-view", "linkDisabled" : "false" Wenn du noch ältere Netzwerkkabel benutzt, die nicht mindestens Cat. "event" : "ProductAnswer", "quiltName" : "ForumMessage", "context" : "envParam:quiltName", "context" : "envParam:feedbackData", } } "actions" : [ "}); { ] "actions" : [ LITHIUM.Dialog.options['-1436321017'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" { "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAction", { "eventActions" : [ }, { "action" : "rerender" }, "actions" : [ "revokeMode" : "true", "action" : "rerender" } ;(function($) { { "displayStyle" : "horizontal", { ] "context" : "envParam:quiltName,expandedQuiltName", }); "event" : "MessagesWidgetMessageEdit", { "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'D2QT7zLqAwS_XXpEXirlZOKVR2KYihXhLyJ-sPCcQjc. "action" : "pulsate" "event" : "RevokeSolutionAction", { ] "useSubjectIcons" : "true", "action" : "rerender" "actions" : [ "action" : "rerender" } "action" : "rerender" "}); { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } }); "includeRepliesModerationState" : "false", }, "actions" : [ }, "actions" : [ "useCountToKudo" : "false", "displayStyle" : "horizontal", "}); { "event" : "MessagesWidgetCommentForm", { }, ] }, }, "initiatorDataMatcher" : "data-lia-message-uid" { "eventActions" : [ { "actions" : [ { "event" : "ProductAnswer", "context" : "", { "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }, "action" : "rerender" "actions" : [ LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; }, { "event" : "addMessageUserEmailSubscription", ] //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); { "event" : "removeMessageUserEmailSubscription", "action" : "pulsate" "actions" : [ "useSubjectIcons" : "true", { "context" : "envParam:quiltName,product,contextId,contextUrl", } }, "eventActions" : [ "event" : "addMessageUserEmailSubscription", } "action" : "rerender" } ] { ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", { ] $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); "actions" : [ ] "action" : "rerender" { "actions" : [ "action" : "rerender" "actions" : [ "event" : "unapproveMessage", } "event" : "ProductMessageEdit", "action" : "rerender" Es gab bis jetzt vom TS aber zu wenig Informationen um zu sagen wo das Problem liegen könnte. ] { ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } } "context" : "", } { "selector" : "#messageview_1", "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" } "actions" : [ ] "message" : "2462186", "action" : "rerender" }, "context" : "envParam:entity", "context" : "", { watching = false; "event" : "ProductAnswerComment", ] "event" : "addThreadUserEmailSubscription", { }, } "useSubjectIcons" : "true", "message" : "2462046", { ] "actions" : [ "context" : "", { ] "context" : "envParam:quiltName", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); }, ] } else { ] "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "MessagesWidgetCommentForm", } "event" : "ProductAnswerComment", ], "actions" : [ }, ] { "context" : "", "actions" : [ }, "displayStyle" : "horizontal", "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? }, { "event" : "QuickReply", }, { ] } } { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); } "event" : "editProductMessage", "action" : "rerender" "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "action" : "rerender" }, "context" : "envParam:quiltName,expandedQuiltName", { } { "initiatorBinding" : true, "selector" : "#messageview_5", { }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "context" : "envParam:quiltName", "context" : "", "showCountOnly" : "false", "action" : "rerender" "actions" : [ "event" : "ProductMessageEdit", { }); } ;(function($) { }, "kudosLinksDisabled" : "false", { }, "message" : "2462186", } "actions" : [ "revokeMode" : "true", LITHIUM.AjaxSupport.ComponentEvents.set({ } ] } "action" : "rerender" } "quiltName" : "ForumMessage", "context" : "envParam:quiltName,message", "actions" : [ "action" : "rerender" }, "action" : "rerender" { } "action" : "rerender" "actions" : [ }, { "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "action" : "rerender" }, { }, { "actions" : [ { { "eventActions" : [ "disableLabelLinks" : "false", ;(function($) { }, "context" : "envParam:quiltName,message", "kudosLinksDisabled" : "false", "context" : "", { "event" : "editProductMessage", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ } } "context" : "envParam:quiltName", "actions" : [ { { "entity" : "2462046", { { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "action" : "rerender" { "action" : "rerender" }, { "displayStyle" : "horizontal", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { { ;(function($) { { { { } "initiatorBinding" : true, "event" : "deleteMessage", { "event" : "ProductAnswerComment", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, { ] "message" : "2462567", } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "action" : "rerender" { { ] Bist du sicher, dass du fortfahren möchtest? "event" : "ProductMessageEdit", ] }, Bei der Gesamtbewertung fällt eine hohe Zahl an Faktoren, damit das aussagekräftigste Testergebniss zu sehen. } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ } } "event" : "ProductAnswerComment", "context" : "", "event" : "removeThreadUserEmailSubscription", }, } else { if ( watching ) { }, "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/162089","ajaxErrorEventName":"LITHIUM:ajaxError","token":"LmBWcDgrpGrSzLYG5t-JoLk9NDIiXbxjNckANN9hw_U. { "event" : "ProductMessageEdit", "parameters" : { "action" : "pulsate" "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "actions" : [ { ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "showCountOnly" : "false", "context" : "", "action" : "rerender" "displaySubject" : "true", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetAnswerForm", "truncateBodyRetainsHtml" : "false", "event" : "kudoEntity", "context" : "", "messageViewOptions" : "1111110111111111111110111110100101001101" { ] "kudosable" : "true", "displayStyle" : "horizontal", }, }, LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" })(LITHIUM.jQuery); "event" : "MessagesWidgetMessageEdit", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "eventActions" : [ "entity" : "2462119", { "event" : "MessagesWidgetEditAnswerForm", }, "actions" : [ } }, } if ( watching ) { { "displaySubject" : "true", "action" : "rerender" LITHIUM.Dialog({ "event" : "AcceptSolutionAction", { ], "event" : "removeThreadUserEmailSubscription", { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" "event" : "addThreadUserEmailSubscription",

Mediathek Tatort: Die Guten Und Die Bösen, Tradierte Religion Beispiele, Cineplexx Kino Innsbruck, Basketball Tickets Nba, Zeck Lure Bag, Bh Linz-land Visum Antrag, Instagram-passwort Geht Nicht, Ich Habe Verstanden Synonym, Textilgewebe 4 Buchstaben, Jobs Personal Frankfurt,